PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG170800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 201aa    MW: 23188.7 Da    PI: 9.6151
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG170800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF76.52.1e-241056248
                         ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
               SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                         rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi++s++gk+y+
  Pavir.7KG170800.1.p 10 RIENPAHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVVSPHGKIYD 56
                         8********************************************97 PP

2K-box51.83.6e-18751722100
                K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                           + +gks e++k++  qqe++ L +ei   q+ +R + Ge d++ ++l eLq Le++Le  + +iRs+K++ + ++ie l++ke  lq +
  Pavir.7KG170800.1.p  75 SEIHGKSREQNKTQAIQQEVSALTREI--FQKGLRYIHGEkDINHMNLGELQALENNLEMWVHNIRSQKMQTMSTEIEMLRNKEGILQAT 162
                          567889999**************9976..89********868************************************************ PP

                K-box  91 nkaLrkklee 100
                          n  L+++++e
  Pavir.7KG170800.1.p 163 NDILQERINE 172
                          *****99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.09E-26173IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-34160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.469161IPR002100Transcription factor, MADS-box
CDDcd002651.92E-35273No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-24323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.47480176IPR002487Transcription factor, K-box
PfamPF014869.0E-2181170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MARGKVQMRR IENPAHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVVSP HGKIYDLATN  60
GNMQGLIERY RRTYSEIHGK SREQNKTQAI QQEVSALTRE IFQKGLRYIH GEKDINHMNL  120
GELQALENNL EMWVHNIRSQ KMQTMSTEIE MLRNKEGILQ ATNDILQERI NEQNGILNFS  180
STVMIPQAPF QLNMESNYYL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.11e-132PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK96e-70MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G86e-70MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLK3YEG81e-132K3YEG8_SETIT; Uncharacterized protein
STRINGSi012632m1e-132(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-56AGAMOUS-like 12